Melittin, C-terminal cysteine labelled

Catalog Number: ISC-AM-210
Article Name: Melittin, C-terminal cysteine labelled
Biozol Catalog Number: ISC-AM-210
Supplier Catalog Number: AM-210
Alternative Catalog Number: ISC-AM-210
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Melittin, C-terminal cysteine labelled is synthetic melittin with an extra cysteine residue at the C terminal. Melittin is a cationic, haemolytic component of honey bee venom used to study cell and liposome lysis. Melittin is a positively charged, amphip
Molecular Weight: 2949.63
NCBI: 1998
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Formula: C134H234N40O32S
Target: Antibacterials
Application Notes: ProductType: Antimicrobial peptides