Candidalysin, CAS [[1906866-53-2]]

Product Overview

• Article Name: Candidalysin, CAS [[1906866-53-2]]
• Biozol Catalog Number: ISC-AM-390
• Supplier Catalog Number: AM-390
• Alternative Catalog Number: ISC-AM-390
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Ece1-III62-92K , CL

Product Description

Candidalysin is a peptide generated by kexin-like proteinase posttranslational processing of the 271-amino-acid preproprotein Ece1p, and is the dominant peptide secreted by the pathogen Candida albicans hyphae during mucosal infection. Candidalysin is a

Product Properties

• Molecular Weight: 3307.95
• NCBI: 2016
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK
• CAS Number: [1906866-53-2]
• Formula: C153H266N38O38S2
• Target: Antifungals

Application Notes

• Application Notes: ProductType: Peptides