Apelin 36 (human), CAS [[252642-12-9]]

Product Overview

• Article Name: Apelin 36 (human), CAS [[252642-12-9]]
• Biozol Catalog Number: ISC-AR-010
• Supplier Catalog Number: AR-010
• Alternative Catalog Number: ISC-AR-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

Apelin-36 (human) is an endogenous apelin receptor agonist that is secreted by adipocytes. Apelin-36 (human) binds with high affinity to human apelin receptors expressed in HEK 293 cells (pIC50= 8.61) and is linked to two major types of biological activi

Product Properties

• Molecular Weight: 4195.87
• NCBI: 1998
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
• CAS Number: [252642-12-9]
• Formula: C184H297N69O43S
• Target: Apelin receptors

Application Notes

• Application Notes: ProductType: Peptides