NT1-20

Catalog Number: ISC-AS-010
Article Name: NT1-20
Biozol Catalog Number: ISC-AS-010
Supplier Catalog Number: AS-010
Alternative Catalog Number: ISC-AS-010
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Peptide NT1-20
NT1-20 is a tatylated membrane penetrating peptide derived from the N-terminus of the acid sensing ion channel 1a (ASIC1a), which can block ASIC1a binding receptor interacting protein kinase 1 (RIPK1) to its C terminus. ASIC1a mediates necroptosis via re
Molecular Weight: 3655.22
NCBI: 2020
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA
Formula: C150H265N55O47S2
Target: Protein-protein interactions,Kinases,Acid sensing ion channels
Application Notes: ProductType: Cell penetrating peptides