CRF (human, rat), CAS [[86784-80-7]]

Product Overview

• Article Name: CRF (human, rat), CAS [[86784-80-7]]
• Biozol Catalog Number: ISC-CR-020
• Supplier Catalog Number: CR-020
• Alternative Catalog Number: ISC-CR-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH

Product Description

CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively. CRF (human, rat) is a major regulator of the h

Product Properties

• Molecular Weight: 4757.51
• NCBI: 1981
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
• CAS Number: [86784-80-7]
• Formula: C208H344N60O63S2
• Target: Corticotropin releasing factor receptors

Application Notes

• Application Notes: ProductType: Peptides