P9R

Catalog Number: ISC-CV-060
Article Name: P9R
Biozol Catalog Number: ISC-CV-060
Supplier Catalog Number: CV-060
Alternative Catalog Number: ISC-CV-060
Manufacturer: Isca Biochemicals
Category: Biochemikalien
P9R is a defensin-like peptide that exhibits potent antiviral activity against pH-dependent viruses, including the avian influenza A(H7N9) virus, coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), and the non-enveloped rhinovirus. The antiviral activity
Molecular Weight: 3412.1
NCBI: 2020
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: NGAICWGPCPTAFRQIGNCGRFRVRCCRIR
Formula: C144H232N52O35S5
Target: Antivirals
Application Notes: ProductType: Antimicrobial peptides