Galanin (human), CAS [[119418-04-1]]

Product Overview

• Article Name: Galanin (human), CAS [[119418-04-1]]
• Biozol Catalog Number: ISC-GA-020
• Supplier Catalog Number: GA-020
• Alternative Catalog Number: ISC-GA-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Galanin (1-30) (human)

Product Description

Galanin (human) is an endogenous peptide with high affinity for all three galanin receptors and multiple endocrine, metabolic and behavioural effects. Named galanin after its N-terminal glycine and its C-terminal alanine, galanin (human) is widely expres

Product Properties

• Molecular Weight: 3155.55
• NCBI: 1991
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
• CAS Number: [119418-04-1]
• Formula: C139H210N42O43
• Target: Galanin receptors

Application Notes

• Application Notes: ProductType: Peptides