Galanin (1-29) (rat, mouse), CAS [[114547-31-8]]

Product Overview

• Article Name: Galanin (1-29) (rat, mouse), CAS [[114547-31-8]]
• Biozol Catalog Number: ISC-GA-030
• Supplier Catalog Number: GA-030
• Alternative Catalog Number: ISC-GA-030
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist, with Ki values of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Galanin (1-29) (rat, mouse) is an anticonvulsant which can prevent the occurrence of full kindled seiz

Product Properties

• Molecular Weight: 3164.48
• NCBI: 1989
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
• CAS Number: [114547-31-8]
• Formula: C141H211N43O41
• Target: Galanin receptors

Application Notes

• Application Notes: ProductType: Peptides