Exendin-4, CAS [[141758-74-9]]

Product Overview

• Article Name: Exendin-4, CAS [[141758-74-9]]
• Biozol Catalog Number: ISC-GH-001
• Supplier Catalog Number: GH-001
• Alternative Catalog Number: ISC-GH-001
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Exenatide

Product Description

Exendin-4, also known as exenatide, is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist originally isolated from Heloderma suspectum venom. It has 50% amino acid homology to GLP-1 and a longer half-life in vivo, and potentiates glucose-in

Product Properties

• Molecular Weight: 4186.6
• NCBI: 1992
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• CAS Number: [141758-74-9]
• Formula: C184H282N50O60S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides