Exendin-4 (3-39) amide, CAS [[196109-31-6]]

Product Overview

• Article Name: Exendin-4 (3-39) amide, CAS [[196109-31-6]]
• Biozol Catalog Number: ISC-GH-008
• Supplier Catalog Number: GH-008
• Alternative Catalog Number: ISC-GH-008
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

Exendin-4 (3-39) amide is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestin

Product Properties

• Molecular Weight: 3992.4
• NCBI: 1
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• CAS Number: [196109-31-6]
• Formula: C176H272N46O58S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides