Exendin-4 (9-39) amide, CAS [[133514-43-9]]

Product Overview

• Article Name: Exendin-4 (9-39) amide, CAS [[133514-43-9]]
• Biozol Catalog Number: ISC-GH-010
• Supplier Catalog Number: GH-010
• Alternative Catalog Number: ISC-GH-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Exendin(9-39) amide, Avexitide, 9-39-Exendin 4 (Heloderma suspectum)

Product Description

Exendin-4 (9-39) amide is a potent and selective glucagon-like peptide-1 (GLP-1) receptor antagonist with a Kd of 1.7 nM at cloned human GLP-1 receptors. Exendin-4 (9-39) amide inhibits cAMP production and insulin release caused by GLP-1 (7-36) and exend

Product Properties

• Molecular Weight: 3369.8 Da
• NCBI: 1991
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• CAS Number: [133514-43-9]
• Formula: C149H234N40O47S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides