GLP-1 (1-37) (human, rat), CAS [[87805-34-3]]

Product Overview

• Article Name: GLP-1 (1-37) (human, rat), CAS [[87805-34-3]]
• Biozol Catalog Number: ISC-GH-020
• Supplier Catalog Number: GH-020
• Alternative Catalog Number: ISC-GH-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: GLP-1 (1-37)

Product Description

GLP-1 (1-37) is a pancreatic hormone resulting from post-translational proteolysis of proglucagon. GLP-1(1-37) does not affect food intake in rats and does not enhance pancreatic insulin. It is secreted by the small intestine in response to nutrient inge

Product Properties

• Molecular Weight: 4169.5
• NCBI: 2003
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
• CAS Number: [87805-34-3]
• Formula: C186H275N51O59
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides