GLP-1 (9-36) amide, CAS [[161748-29-4]]

Product Overview

• Article Name: GLP-1 (9-36) amide, CAS [[161748-29-4]]
• Biozol Catalog Number: ISC-GH-040
• Supplier Catalog Number: GH-040
• Alternative Catalog Number: ISC-GH-040
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Glucagon-like peptide-1 (9-36) amide

Product Description

GLP-1 (9-36) amide, or Glucagon-like peptide-1 (9-36) amide, is a glucoregulatory peptide and the human N-terminally truncated major metabolite of glucagon-like peptide GLP-1 (7-36) amide, formed by dipeptidyl peptidase-IV (DPP IV) cleavage. GLP-1 (9-36)

Product Properties

• Molecular Weight: 3089.4
• NCBI: 1996
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
• CAS Number: [161748-29-4]
• Formula: C140H214N36O43
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides