GLP-1 (7-36) amide (human, rat), CAS [[107444-51-9]]

Product Overview

• Article Name: GLP-1 (7-36) amide (human, rat), CAS [[107444-51-9]]
• Biozol Catalog Number: ISC-GH-050
• Supplier Catalog Number: GH-050
• Alternative Catalog Number: ISC-GH-050
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors exp

Product Properties

• Molecular Weight: 3297.7
• NCBI: 2000
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
• CAS Number: [107444-51-9]
• Formula: C149H226N40O45
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides