Neuropeptide Y (human, rat), CAS [[90880-35-6]]

Product Overview

• Article Name: Neuropeptide Y (human, rat), CAS [[90880-35-6]]
• Biozol Catalog Number: ISC-GH-060
• Supplier Catalog Number: GH-060
• Alternative Catalog Number: ISC-GH-060
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide which mediates its physiological effects through at least four receptors, Y1, Y2, Y4, and Y5. Neuropeptide Y (human, rat) is one of the most abundant peptides in the central nerv

Product Properties

• Molecular Weight: 4271.7
• NCBI: 1998
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
• CAS Number: [90880-35-6]
• Formula: C189H285N55O57S
• Target: Neuropeptide Y receptors

Application Notes

• Application Notes: ProductType: Peptides