Oxyntomodulin, CAS [[62340-29-8]]

Product Overview

• Article Name: Oxyntomodulin, CAS [[62340-29-8]]
• Biozol Catalog Number: ISC-GH-070
• Supplier Catalog Number: GH-070
• Alternative Catalog Number: ISC-GH-070
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: OXM, Glucagon 37

Product Description

Oxyntomodulin is an endogenous glucagon-like peptide from the preproglucagon family that is secreted by intestinal L-cells. Oxyntomodulin binds to and activates the glucagon-like peptide (GLP-1) receptor, with its anorectic effects being blocked by the G

Product Properties

• Molecular Weight: 4421.86
• NCBI: 1981
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
• CAS Number: [62340-29-8]
• Formula: C192H295N59O60S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides