Peptide YY (human), CAS [[118997-30-1]]

Product Overview

• Article Name: Peptide YY (human), CAS [[118997-30-1]]
• Biozol Catalog Number: ISC-GH-110
• Supplier Catalog Number: GH-110
• Alternative Catalog Number: ISC-GH-110
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: PYY, PYY (1-36)

Product Description

Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine r

Product Properties

• Molecular Weight: 4049.5
• NCBI: 1980
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
• CAS Number: [118997-30-1]
• Formula: C194H295N55O57
• Target: Neuropeptide Y receptors

Application Notes

• Application Notes: ProductType: Peptides