Peptide YY (3-36) (human), CAS [[126339-09-1]]

Product Overview

• Article Name: Peptide YY (3-36) (human), CAS [[126339-09-1]]
• Biozol Catalog Number: ISC-GH-120
• Supplier Catalog Number: GH-120
• Alternative Catalog Number: ISC-GH-120
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

PYY (3-36) is the N-terminal truncated metabolite of PYY1-36 and is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. PYY(3-36) reduces appetite and inhibits food intake through action as a Y2 recepto

Product Properties

• Molecular Weight: 4049.6
• NCBI: 2002
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
• CAS Number: [126339-09-1]
• Formula: C180H279N53O54
• Target: Neuropeptide Y receptors

Application Notes

• Application Notes: ProductType: Peptides