GIP (human), CAS [[100040-31-1]]

Product Overview

• Article Name: GIP (human), CAS [[100040-31-1]]
• Biozol Catalog Number: ISC-GH-150
• Supplier Catalog Number: GH-150
• Alternative Catalog Number: ISC-GH-150
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide

Product Description

GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake

Product Properties

• Molecular Weight: 4983.6
• NCBI: 1995
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
• CAS Number: [100040-31-1]
• Formula: C226H338N60O66S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides