GIP (1-39), CAS [[725474-97-5]]

Product Overview

• Article Name: GIP (1-39), CAS [[725474-97-5]]
• Biozol Catalog Number: ISC-GH-160
• Supplier Catalog Number: GH-160
• Alternative Catalog Number: ISC-GH-160
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

GIP (1-39) is a highly potent insulinotropic peptide, it is the endogenous truncated form of the incretin hormone GIP (Glucose-dependent Insulinotropic Polypeptide, or Gastric Inhibitory Polypeptide), a 42-amino acid peptide released by the K cells of th

Product Properties

• Molecular Weight: 4633.2
• NCBI: 2004
• Purity: >95% By HPLC
• Form: Freeze dried solid
• Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
• CAS Number: [725474-97-5]
• Formula: C210H316N56O61S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides