GIP-1 (3-42) (human), CAS [[1802086-25-4]]

Product Overview

• Article Name: GIP-1 (3-42) (human), CAS [[1802086-25-4]]
• Biozol Catalog Number: ISC-GH-170
• Supplier Catalog Number: GH-170
• Alternative Catalog Number: ISC-GH-170
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

GIP (3-42) is produced by cleavage of the first two amino acid residues at the N-terminal (Tyr1-Ala2) from GIP (1-42), also known as GIP, by the serine protease dipeptidyl peptidase IV (DPP-IV). GIP (3-42) itself has no biological activity, but it can co

Product Properties

• Molecular Weight: 4749.4
• NCBI: 2006
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
• CAS Number: [1802086-25-4]
• Formula: C214H324N58O63S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides