GIP (porcine), CAS [[11063-17-5]]

Product Overview

• Article Name: GIP (porcine), CAS [[11063-17-5]]
• Biozol Catalog Number: ISC-GL-020
• Supplier Catalog Number: GL-020
• Alternative Catalog Number: ISC-GL-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Glucose dependent insulinotropic polypeptide (porcine), Gastric inhibitory peptide (porcine)

Product Description

GIP is a member of a family of structurally related hormones that includes secretin, glucagon, and vasoactive intestinal peptide. GIP (human) differs from GIP (porcine) at residues 18 and 34. GIP is secreted from specific endocrine cells (K-cells) in the

Product Properties

• Molecular Weight: 4975.62
• NCBI: 1986
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
• CAS Number: [11063-17-5]
• Formula: C225H342N60O66S
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides