GLP-1 (7-37), CAS [[106612-94-6]]

Product Overview

• Article Name: GLP-1 (7-37), CAS [[106612-94-6]]
• Biozol Catalog Number: ISC-GL-030
• Supplier Catalog Number: GL-030
• Alternative Catalog Number: ISC-GL-030
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Glucagon like peptide 1 fragment 7-37 (human)

Product Description

GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion.

Product Properties

• Molecular Weight: 3355.71
• NCBI: 1995
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
• CAS Number: [106612-94-6]
• Formula: C151H228N40O47
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides