GIP_HUMAN[22-51]

Product Overview

• Article Name: GIP_HUMAN[22-51]
• Biozol Catalog Number: ISC-GL-040
• Supplier Catalog Number: GL-040
• Alternative Catalog Number: ISC-GL-040
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

GIP_HUMAN[22-51] is a potent proatherosclerotic peptide hormone which has a common precursor with glucose-dependent insulinotropic polypeptide (GIP). Chronic infusion of GIP_HUMAN

Product Properties

• Molecular Weight: 3181.6
• NCBI: 2021
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: EKKEGHFSALPSLPVGSHAKVSSPQPRGPR
• Formula: C140H226N44O41
• Target: Glucagon and related receptors

Application Notes

• Application Notes: ProductType: Peptides