ACTH (1-39) (human), CAS [[12279-41-3]]

Product Overview

• Article Name: ACTH (1-39) (human), CAS [[12279-41-3]]
• Biozol Catalog Number: ISC-MC-020
• Supplier Catalog Number: MC-020
• Alternative Catalog Number: ISC-MC-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Adrenocorticotropic hormone, Corticotropin, ACTH (1-39)

Product Description

ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior

Product Properties

• Molecular Weight: 4541.1
• NCBI: 1996
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• CAS Number: [12279-41-3]
• Formula: C207H308N56O58S
• Target: Melanocortin receptors

Application Notes

• Application Notes: ProductType: Peptides