aCx26-pep

Catalog Number: ISC-NR-200
Article Name: aCx26-pep
Biozol Catalog Number: ISC-NR-200
Supplier Catalog Number: NR-200
Alternative Catalog Number: ISC-NR-200
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Cx26 peptide
aCx26-pep is a peptide consisting of the gap junction protein connexin 26 (Cx26) cytosolic tail sequence, coupled to antennapedia. Triple negative breast cancer (TNBC) is one of the most lethal and treatment resistant breast cancer subtypes and it contai
Molecular Weight: 3477.97
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: RQIKIWFQNRRMKWKKRYCSGKSKKPV-NH2
Formula: C158H260N52O33S2
Target: Nuclear receptor modulators,Protein-protein interactions
Application Notes: ProductType: Cell penetrating peptides