Neuromedin S (human), CAS [[1138204-27-9]]

Product Overview

• Article Name: Neuromedin S (human), CAS [[1138204-27-9]]
• Biozol Catalog Number: ISC-NU-010
• Supplier Catalog Number: NU-010
• Alternative Catalog Number: ISC-NU-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: NMS (human), hNMS-33

Product Description

Neuromedin S (human) is a 33-amino acid neuropeptide, originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have since been identified as the neuromedin U receptors NMU1 and

Product Properties

• Molecular Weight: 3789.01
• NCBI: 2005
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
• CAS Number: [1138204-27-9]
• Formula: C173H265N53O44
• Target: Neuromedin U receptors

Application Notes

• Application Notes: ProductType: Peptides