Pancreatic polypeptide (human), CAS [[75976-10-2]]

Product Overview

• Article Name: Pancreatic polypeptide (human), CAS [[75976-10-2]]
• Biozol Catalog Number: ISC-NY-030
• Supplier Catalog Number: NY-030
• Alternative Catalog Number: ISC-NY-030
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Pancreatic polypeptide, PP

Product Description

Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of L

Product Properties

• Molecular Weight: 4181.7
• NCBI: 1995
• Purity: >95%
• Form: Freeze dried solid
• Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
• CAS Number: [75976-10-2]
• Formula: C185H287N53O54S2
• Target: Neuropeptide Y receptors

Application Notes

• Application Notes: ProductType: Peptides