PACAP 27, CAS [[127317-03-7]]

Product Overview

• Article Name: PACAP 27, CAS [[127317-03-7]]
• Biozol Catalog Number: ISC-PA-010
• Supplier Catalog Number: PA-010
• Alternative Catalog Number: ISC-PA-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: PACAP 1-27, Pituitary Adenylate Cyclase-Activating Polypeptide 1-27, PACAP-38 (1-27) amide (human, mouse, ovine, porcine, rat)

Product Description

PACAP 27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 func

Product Properties

• Molecular Weight: 3147.65
• NCBI: 1997
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
• CAS Number: [127317-03-7]
• Formula: C142H224N40O39S
• Target: PACAP receptors

Application Notes

• Application Notes: ProductType: Peptides