PACAP 38, CAS [[124123-15-5]]

Product Overview

• Article Name: PACAP 38, CAS [[124123-15-5]]
• Biozol Catalog Number: ISC-PA-020
• Supplier Catalog Number: PA-020
• Alternative Catalog Number: ISC-PA-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38, PACAP 1-38

Product Description

PACAP 38, or Pituitary adenylate cyclase activating polypeptide-38, is a widely distributed endogenous neuropeptide located in both sensory and parasympathetic perivascular nerve fibes. PACAP 38 acts primarily as a PAC1 agonist and is involved in neuropr

Product Properties

• Molecular Weight: 4534.32
• NCBI: 1998
• Purity: 95% by hplc
• Form: Freeze dried solid
• Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH,,
• CAS Number: [124123-15-5]
• Formula: C,,,€,fH,f,f,N,+,fO,_,fS
• Target: PACAP receptors

Application Notes

• Application Notes: ProductType: Peptides