PACAP (6-38), CAS [[143748-18-9]]

Product Overview

• Article Name: PACAP (6-38), CAS [[143748-18-9]]
• Biozol Catalog Number: ISC-PA-030
• Supplier Catalog Number: PA-030
• Alternative Catalog Number: ISC-PA-030
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: PACAP 6-38, Pituitary adenylate cyclase activating polypeptide (6-38)

Product Description

PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist with an IC50 of 2 nM. PACAP(6-38)] is a potent mast cell degranulator and has an agonistic effect on MrgB3-receptors expressed in oocyt

Product Properties

• Molecular Weight: 4024.8
• NCBI: 1999
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
• CAS Number: [143748-18-9]
• Formula: C182H300N56O45S
• Target: PACAP receptors

Application Notes

• Application Notes: ProductType: Peptides