Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]

Product Overview

• Article Name: Parathyroid hormone (1-34) (human), CAS [[52232-67-4]]
• Biozol Catalog Number: ISC-PH-010
• Supplier Catalog Number: PH-010
• Alternative Catalog Number: ISC-PH-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34)

Product Description

Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland. Intermittently administered p

Product Properties

• Molecular Weight: 4117.77
• NCBI: 1997
• Purity: >95%
• Form: Freeze fried solid
• Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
• CAS Number: [52232-67-4]
• Formula: C181H291N55O51S2
• Target: Parathyroid hormone receptors

Application Notes

• Application Notes: ProductType: Peptides