TIP 39

Product Overview

• Article Name: TIP 39
• Biozol Catalog Number: ISC-PH-020
• Supplier Catalog Number: PH-020
• Alternative Catalog Number: ISC-PH-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues

Product Description

TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and select

Product Properties

• Molecular Weight: 4504.24
• NCBI: 1999
• Purity: >95%
• Form: Freeze dried solid
• Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
• Formula: C202H325N61O54S
• Target: Parathyroid hormone receptors

Application Notes

• Application Notes: ProductType: Peptides