Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]

Product Overview

• Article Name: Parathyroid hormone (1-34) (rat), CAS [[98614-76-7]]
• Biozol Catalog Number: ISC-PH-040
• Supplier Catalog Number: PH-040
• Alternative Catalog Number: ISC-PH-040
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: pTH (1-34) (rat)

Product Description

Parathyroid hormone (1-34) (rat) is a parathyroid hormone receptor agonist, which can increase serum parathyroid hormone levels and bone mass in rats. Parathyroid hormone (1-34) (rat) treatment significantly improved weight bearing and treadmill enduranc

Product Properties

• Molecular Weight: 4057.74
• NCBI: 1997
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
• CAS Number: [98614-76-7]
• Formula: C180H291N55O48S2
• Target: Parathyroid hormone receptors

Application Notes

• Application Notes: ProductType: Peptides