WaTx

Catalog Number: ISC-PN-120
Article Name: WaTx
Biozol Catalog Number: ISC-PN-120
Supplier Catalog Number: PN-120
Alternative Catalog Number: ISC-PN-120
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Wasabi receptor toxin
WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which
Molecular Weight: 3855.3
NCBI: 2019
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS
Formula: C164H245N45O53S5
Target: Transient receptor potential (TRP) channels
Application Notes: ProductType: Peptides