Tat-beclin 1, CAS [[1423821-88-8]]

Product Overview

• Article Name: Tat-beclin 1, CAS [[1423821-88-8]]
• Biozol Catalog Number: ISC-PP-200
• Supplier Catalog Number: PP-200
• Alternative Catalog Number: ISC-PP-200
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide

Product Description

Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regu

Product Properties

• Molecular Weight: 3741.15
• NCBI: 2013
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
• CAS Number: [1423821-88-8]
• Formula: C164H251N57O45
• Target: Protein-protein interactions,Antivirals

Application Notes

• Application Notes: ProductType: Cell penetrating peptides