KP1

Product Overview

• Article Name: KP1
• Biozol Catalog Number: ISC-PP-290
• Supplier Catalog Number: PP-290
• Alternative Catalog Number: ISC-PP-290
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: KP1 (human), Klotho-derived peptide 1

Product Description

KP1 is a peptide representing the sequence Phe57 to Lys86 of the anti aging protein Klotho, and is one of the buried beta-strands in the N-terminal domain. KP1 mimics the anti-fibrotic action of Klotho by constraining TGF-beta signaling, KP1 acts through bindi

Product Properties

• Molecular Weight: 3228.48
• NCBI: 2022
• Purity: >95% by HPLC
• Form: Freeze dried solid
• Sequence: FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
• Formula: C149H203N39O43
• Target: Protein-protein interactions

Application Notes

• Application Notes: ProductType: Peptides