tatM2NX

Product Overview

• Article Name: tatM2NX
• Biozol Catalog Number: ISC-TP-010
• Supplier Catalog Number: TP-010
• Alternative Catalog Number: ISC-TP-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

tatM2NX is a peptide generated by fusing part of the C-terminus of transient receptor potential melastin 2 (TRPM2) channels, corresponding more than 90% with the Nudix domain (M2NX), with the tat inducer of HIV. tatM2NX is a TRPM2 antagonist which preven

Product Properties

• Molecular Weight: 4354.17
• NCBI: 2016
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV
• Formula: C190H323N71O45 S
• Target: Transient receptor potential (TRP) channels

Application Notes

• Application Notes: ProductType: Cell penetrating peptides