VIP, CAS [[40077-57-4]]

Product Overview

• Article Name: VIP, CAS [[40077-57-4]]
• Biozol Catalog Number: ISC-VP-010
• Supplier Catalog Number: VP-010
• Alternative Catalog Number: ISC-VP-010
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien
• Alternative Names: VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil

Product Description

VIP (Vasoactive intestinal peptide) is a 28 amino acid peptide originally isolated from swine intestines and found to be vasoactive by dilating arterioles. VIP is widely distributed in both the central and peripheral nervous system and is released by bot

Product Properties

• Molecular Weight: 3325.8
• NCBI: 2002
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
• CAS Number: [40077-57-4]
• Formula: C147H238N44O42S
• Target: Vasoactive intestinal peptide (VIP) receptors

Application Notes

• Application Notes: ProductType: Peptides