Bay 55-9837, CAS [[463930-25-8]]

Product Overview

• Article Name: Bay 55-9837, CAS [[463930-25-8]]
• Biozol Catalog Number: ISC-VP-020
• Supplier Catalog Number: VP-020
• Alternative Catalog Number: ISC-VP-020
• Manufacturer: Isca Biochemicals
• Category: Biochemikalien

Product Description

Bay 55-9837 is a selective vasoactive intestinal peptide receptor 2 (VPAC2 receptor) agonist, binding to VPAC2 with a Kd of 0.65 nmol/l and having greater than 100-fold selectivity over VPAC1. BAY 55-9837 stimulates glucose-dependent insulin secretion in

Product Properties

• Molecular Weight: 3742.29
• NCBI: 2002
• Purity: >95% by hplc
• Form: Freeze dried solid
• Sequence: HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2
• CAS Number: [463930-25-8]
• Formula: C167H270N52O46
• Target: Vasoactive intestinal peptide (VIP) receptors

Application Notes

• Application Notes: ProductType: Peptides