Histone H3 Antibody LS-C332079, Unconjugated, Rabbit, Polyclonal

Catalog Number: LS-C332079-100
Article Name: Histone H3 Antibody LS-C332079, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: LS-C332079-100
Supplier Catalog Number: LS-C332079-100
Alternative Catalog Number: LS-C332079-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human HIST3H3 (NP_003484.1). REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Conjugation: Unconjugated
Clonality: Polyclonal
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Notes: ChIP-Seq (1:50 - 1:200), ChrIP, IF (1:50 - 1:200), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
Western blot analysis of extracts of various cells.
Immunohistochemistry of paraffin-embedded Rat liver tissue.
Immunoprecipitation analysis of 150ug extracts of MCF7 cells.