SUMO2 Antibody LS-C332176, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: SUMO2 Antibody LS-C332176, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: LS-C332176-20
• Supplier Catalog Number: LS-C332176-20
• Alternative Catalog Number: LS-C332176-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3). MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
• Conjugation: Unconjugated
• Alternative Names: SUMO2, HSMT3, SMT3 homolog 2, SMT3A, Sentrin 2, Smt3B, SMT3H2, SUMO-2, SUMO-3, Sentrin-2, Ubiquitin-like protein SMT3A, Ubiquitin-like protein SMT3B

Product Properties

• Clonality: Polyclonal
• NCBI: 6613
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Notes: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)

Images

Western blot analysis of extracts of various cell lines, using SUMO2 antibody.

Immunofluorescence analysis of U2OS cell using SUMO2 antibody. Blue: DAPI for nuclear staining.

Immunohistochemistry of paraffin-embedded rat lung tissue.