PVRL4 / Nectin 4 Antibody LS-C781892, Unconjugated, Rabbit, Polyclonal
Catalog Number:
LS-C781892-100
| Article Name: |
PVRL4 / Nectin 4 Antibody LS-C781892, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
LS-C781892-100 |
| Supplier Catalog Number: |
LS-C781892-100 |
| Alternative Catalog Number: |
LS-C781892-100 |
| Manufacturer: |
LifeSpan Biosciences |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Species Reactivity: |
Human |
| Immunogen: |
Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
PVRL4, EDSS1, Nectin 4, Ig superfamily receptor LNIR, Poliovirus receptor-like 4, LNIR, Nectin-4, Poliovirus receptor-related 4 |
| Clonality: |
Polyclonal |
| NCBI: |
81607 |
| Purity: |
Antigen Affinity purification |
| Form: |
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide. |
| Application Notes: |
WB (0.5 - 1 µg/ml) |
