[KO Validated] RB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0003T
Article Name: [KO Validated] RB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0003T
Supplier Catalog Number: CNA0003T
Alternative Catalog Number: MBL-CNA0003T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human RB (NP_000312.2).
Conjugation: Unconjugated
Alternative Names: RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1
Clonality: Polyclonal
Molecular Weight: 106kDa
NCBI: 5925
UniProt: P06400
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
Target: RB1
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200