PTEN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0008P
Article Name: PTEN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0008P
Supplier Catalog Number: CNA0008P
Alternative Catalog Number: MBL-CNA0008P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human PTEN (NP_000305.3).
Conjugation: Unconjugated
Alternative Names: BZS, DEC, CWS1, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del, PTENbeta
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 5728
UniProt: P60484
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHL
Target: PTEN
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200