Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA0028T
• Supplier Catalog Number: CNA0028T
• Alternative Catalog Number: MBL-CNA0028T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, WB
• Species Reactivity: Mouse, Rat
• Immunogen: A synTyrosine Hydroxylase etic peptide corresponding to a sequence wiTyrosine Hydroxylase in amino acids 1-100 of human Tyrosine Hydroxylase (NP_954986.2).
• Conjugation: Unconjugated
• Alternative Names: TYH, DYT14, DYT5b

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 59kDa
• NCBI: 7054
• UniProt: P07101
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLE
• Target: TH

Application Notes

• Application Dilute: WB: WB,1:500 - 1:1000