STIP1 Rabbit mAb, Clone: [ARC1805], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0036S
Article Name: STIP1 Rabbit mAb, Clone: [ARC1805], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0036S
Supplier Catalog Number: CNA0036S
Alternative Catalog Number: MBL-CNA0036S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2-98 of human STIP1 (P31948).
Conjugation: Unconjugated
Alternative Names: HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521
Clonality: Monoclonal
Clone Designation: [ARC1805]
Molecular Weight: 63kDa
NCBI: 10963
UniProt: P31948
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEG
Target: STIP1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200