Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0053S
Article Name: Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0053S
Supplier Catalog Number: CNA0053S
Alternative Catalog Number: MBL-CNA0053S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Conjugation: Unconjugated
Alternative Names: TRX, TRDX, TRX1, Trx80
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 7295
UniProt: P10599
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT
Target: TXN
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200