VEGFR1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0058T
Article Name: VEGFR1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0058T
Supplier Catalog Number: CNA0058T
Alternative Catalog Number: MBL-CNA0058T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1100-1180 of human VEGFR1 (NP_002010.2).
Conjugation: Unconjugated
Alternative Names: FLT, FLT-1, VEGFR1, VEGFR-1
Clonality: Polyclonal
Molecular Weight: 151kDa
NCBI: 2321
UniProt: P17948
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNS
Target: FLT1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200