CYP1A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0062S
Article Name: CYP1A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0062S
Supplier Catalog Number: CNA0062S
Alternative Catalog Number: MBL-CNA0062S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 205-305 of human CYP1A2 (NP_000752.2).
Conjugation: Unconjugated
Alternative Names: CP12, CYPIA2, P3-450, P450(PA)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 1544
UniProt: P05177
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: FGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQE
Target: CYP1A2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200